PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00017336-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family bHLH
Protein Properties Length: 280aa    MW: 31609.1 Da    PI: 6.0954
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00017336-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH43.65.3e-1498147455
                         HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                         +hn+ Er RR+++N  ++ Lr+llP+a   + kKls  +++ ++ +YI +Lq
  WALNUT_00017336-RA  98 NHNASERDRRKKMNGLYSSLRSLLPEA--DQMKKLSIPTTVSRVLKYIPELQ 147
                         8*************************6..49999***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.04394146IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.91E-1295150No hitNo description
SuperFamilySSF474595.76E-1495162IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.3E-1296162IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.3E-1198147IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.2E-8100152IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MMIISVLLTI QVVSNCQPNY SMMLALSPPS WFSNNGSSSY FHQYSISQDQ NYVHRDNDTL  60
ESALHFLSCE TVQEVGLDPA TAPTPVSHGD PKMVKKFNHN ASERDRRKKM NGLYSSLRSL  120
LPEADQMKKL SIPTTVSRVL KYIPELQKQV VGLIQNKEEL LSMISSQTDI ETQHEHEMMN  180
QPKTIARSSL STVSASRLND TEVMIQISTC KINNNTPLSE ILLSLEEVGL LLLNVSSFES  240
FGGRVFYGLH LQGERNQILE FEILSEKLMS LYDKREAPLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653965.13e-79PREDICTED: transcription factor ORG2
SwissprotQ9M1K13e-57ORG2_ARATH; Transcription factor ORG2
TrEMBLD7TIN83e-79D7TIN8_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g05300.t011e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.17e-49bHLH family protein